PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g005960.1
Common NameMTR_8g005960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 328aa    MW: 36196.6 Da    PI: 8.5986
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g005960.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.92.1e-41186263178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cq+egC+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+q+
  Medtr8g005960.1 186 RCQAEGCNADLSQAKHYHRRHKVCEFHSKAATVVAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKTQH 263
                      6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-35180248IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.394184261IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-38185264IPR004333Transcription factor, SBP-box
PfamPF031103.2E-31187260IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MLDYEWGNPS NIMLTGNEDN SGAAATDQAH RQIFDHYASQ AMLSDNYLNG PGGGPTIDIN  60
SGDFTHHHNQ FSPHNQQHHN IHQSFFDPRA FHGGSSTASS YPPPQPQPPP SMLSLDPLPG  120
HGHSPGFLLV PKSEDVNRPI DFVGSRLGLN LGGRTYFSSE DDFVTRLYRR SRPPEPGSTG  180
SSNSPRCQAE GCNADLSQAK HYHRRHKVCE FHSKAATVVA AGLTQRFCQQ CSRFHLLSEF  240
DNGKRSCRKR LADHNRRRRK TQHPNTQDIH KSHNTLDSSA TRSPPESGTQ STSSVTVAVS  300
PPDYFRQRSY QTPSPSTTSS SMFFSTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-33177260184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.143430.0flower
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1828150.0AC182815.52 Medicago truncatula chromosome 8 clone mth2-177e24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003626693.10.0squamosa promoter-binding-like protein
TrEMBLG7LBJ70.0G7LBJ7_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA07G14610.11e-141(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68013348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.13e-71squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]